General Information

  • ID:  hor000081
  • Uniprot ID:  P16041
  • Protein name:  Vasotocin
  • Gene name:  NA
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CYIQNCPRG
  • Length:  9
  • Propeptide:  MPYSTFPLLWVLGLLALSSACYIQNCPRGGKRSFPDLPRQCMSCGPGDRGRCFGPNICCGEGMGCYMGSPEAAGCVEENYLPSPCEAGGRVCGSEGSCAASGVCCDSESCVLDPDCLEDSKRQSPSEQNAALMGGLAGDLLRILHATSRGRPQ
  • Signal peptide:  MPYSTFPLLWVLGLLALSSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Antidiuretic hormone
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-6
  • Structure ID:  AF-P35455-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P35455-F1.pdbhor000081_AF2.pdbhor000081_ESM.pdb

Physical Information

Mass: 119610 Formula: C43H68N14O13S2
Absent amino acids: ADEFHKLMSTVW Common amino acids: C
pI: 8.22 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 1
Hydrophobicity: -58.89 Boman Index: -1882
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 43.33
Instability Index: 927.78 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  2045542
  • Title:  Cloning and Sequence Analyses of cDNAs Encoding Vasotocin and Isotocin Precursors of Chum Salmon, Oncorhynchus Keta: Evolutionary Relationships of Neurohypophysial Hormone Precursors